PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN20229.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 120aa    MW: 13611.4 Da    PI: 8.4773
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN20229.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB125.71.8e-391811797
       NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                mk++lP  akisk+ k+++qecv+efisfvt+easdkc++e+rkt+ngdd++wal++lGf++y+e++  yl+ yr+ e+ek
  KHN20229.1  1 MKQILPPSAKISKEGKQLMQECVTEFISFVTGEASDKCHKENRKTVNGDDICWALSSLGFDNYAEAIGRYLHIYRQGEREK 81
                9***************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471136.61E-29192IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.2E-37194IPR009072Histone-fold
PfamPF008081.0E-18155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-161937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-163856No hitNo description
PRINTSPR006151.5E-165775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MKQILPPSAK ISKEGKQLMQ ECVTEFISFV TGEASDKCHK ENRKTVNGDD ICWALSSLGF  60
DNYAEAIGRY LHIYRQGERE KINHTKKYEN PQNQTQINRA PPPPLLLSRV ENPPPTNQSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-311761792Transcription factor HapC (Eurofung)
4g92_B1e-311761792Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2359141e-122AC235914.2 Glycine max clone GM_WBc0225O17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555607.14e-87PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040276e-47NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A0B2QJ504e-87A0A0B2QJ50_GLYSO; Nuclear transcription factor Y subunit B-4
TrEMBLK7N5935e-87K7N593_SOYBN; Uncharacterized protein
TrEMBLK7N5944e-87K7N594_SOYBN; Uncharacterized protein
STRINGGLYMA20G37870.21e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.14e-48nuclear factor Y, subunit B4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]